Reptin/RUVBL2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1905S
Article Name: Reptin/RUVBL2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1905S
Supplier Catalog Number: CNA1905S
Alternative Catalog Number: MBL-CNA1905S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-463 of human Reptin/Reptin/RUVBL2 (NP_006657.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 51kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRT
Target: RUVBL2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100