[KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb, Clone: [ARC53508], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19062P
Article Name: [KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb, Clone: [ARC53508], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19062P
Supplier Catalog Number: CNA19062P
Alternative Catalog Number: MBL-CNA19062P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC53508]
Molecular Weight: 33kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPR
Target: HMOX1
Application Dilute: WB: WB,1:2000 - 1:10000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000