Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb, Clone: [ARC0370], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19069S
Article Name: Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb, Clone: [ARC0370], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19069S
Supplier Catalog Number: CNA19069S
Alternative Catalog Number: MBL-CNA19069S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: FC, ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0370]
Molecular Weight: 115kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Target: ITGA5
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000|FC,1:50 - 1:200