Integrin alpha V (ITGAV/CD51) Rabbit mAb, Clone: [ARC50621], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19071P
Article Name: Integrin alpha V (ITGAV/CD51) Rabbit mAb, Clone: [ARC50621], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19071P
Supplier Catalog Number: CNA19071P
Alternative Catalog Number: MBL-CNA19071P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: FC, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V (ITGAV/CD51) (NP_002201.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC50621]
Molecular Weight: 116kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Target: ITGAV
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|FC,1:50 - 1:200