[KO Validated] MyD88 Rabbit mAb, Clone: [ARC52507], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19082P
Article Name: [KO Validated] MyD88 Rabbit mAb, Clone: [ARC52507], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19082P
Supplier Catalog Number: CNA19082P
Alternative Catalog Number: MBL-CNA19082P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MyD88 (NP_002459.3).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC52507]
Molecular Weight: 15kDa/20kDa/28kDa/31kDa/33kDa/34kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: LAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL
Target: MYD88
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:500 - 1:1000