ENO2 Rabbit mAb, Clone: [ARC52246], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19091P
Article Name: ENO2 Rabbit mAb, Clone: [ARC52246], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19091P
Supplier Catalog Number: CNA19091P
Alternative Catalog Number: MBL-CNA19091P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 47-100 of human ENO2 (NP_001966.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC52246]
Molecular Weight: 47kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: LELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANA
Target: ENO2
Application Dilute: WB: WB,1:2000 - 1:10000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200