[KO Validated] Smad1 Rabbit mAb, Clone: [ARC52105], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19113P
Article Name: [KO Validated] Smad1 Rabbit mAb, Clone: [ARC52105], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19113P
Supplier Catalog Number: CNA19113P
Alternative Catalog Number: MBL-CNA19113P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-240 of human Smad1 (NP_005891.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC52105]
Molecular Weight: 52kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: WKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
Target: SMAD1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000