[KO Validated] Smad3 Rabbit mAb, Clone: [ARC53861], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19115P
Article Name: [KO Validated] Smad3 Rabbit mAb, Clone: [ARC53861], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19115P
Supplier Catalog Number: CNA19115P
Alternative Catalog Number: MBL-CNA19115P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC53861]
Molecular Weight: 48kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: HHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM
Target: SMAD3
Application Dilute: WB: WB,1:2000 - 1:20000|IHC-P,1:50 - 1:200|IP,1:100 - 1:500