[KO Validated] SUMO1 Rabbit mAb, Clone: [ARC0215], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19121S
Article Name: [KO Validated] SUMO1 Rabbit mAb, Clone: [ARC0215], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19121S
Supplier Catalog Number: CNA19121S
Alternative Catalog Number: MBL-CNA19121S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-101 of human Sumo 1 (P63165).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0215]
Molecular Weight: 12kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Target: SUMO1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200