Synaptophysin Rabbit mAb, Clone: [ARC0427], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19122S
Article Name: Synaptophysin Rabbit mAb, Clone: [ARC0427], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19122S
Supplier Catalog Number: CNA19122S
Alternative Catalog Number: MBL-CNA19122S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Synaptophysin (NP_003170.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0427]
Molecular Weight: 34kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGY
Target: SYP
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200