TDP-43/TARDBP Rabbit mAb, Clone: [ARC0492], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19123S
Article Name: TDP-43/TARDBP Rabbit mAb, Clone: [ARC0492], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19123S
Supplier Catalog Number: CNA19123S
Alternative Catalog Number: MBL-CNA19123S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TDP-43/TARDB (Q13148).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0492]
Molecular Weight: 45kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGG
Target: TARDBP
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ChIP,1:50 - 1:200