TNFAIP3 Rabbit mAb, Clone: [ARC0355], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19128S
Article Name: TNFAIP3 Rabbit mAb, Clone: [ARC0355], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19128S
Supplier Catalog Number: CNA19128S
Alternative Catalog Number: MBL-CNA19128S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TNFAIP3 (P21580).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0355]
Molecular Weight: 90kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSS
Target: TNFAIP3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200