[KO Validated] YAP1 Rabbit mAb, Clone: [ARC53477], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19134P
Article Name: [KO Validated] YAP1 Rabbit mAb, Clone: [ARC53477], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19134P
Supplier Catalog Number: CNA19134P
Alternative Catalog Number: MBL-CNA19134P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC53477]
Molecular Weight: 36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYS
Target: YAP1
Application Dilute: WB: WB,1:2000 - 1:4000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500