CXCL10/IP-10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA19138P
Article Name: CXCL10/IP-10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA19138P
Supplier Catalog Number: CNA19138P
Alternative Catalog Number: MBL-CNA19138P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-98 of human CXCL10/IP-10 (NP_001556.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 11kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Target: CXCL10
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200