CNTF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1915T
Article Name: CNTF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1915T
Supplier Catalog Number: CNA1915T
Alternative Catalog Number: MBL-CNA1915T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 24-74 of human CNTF (NP_000605.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 23kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQ
Target: CNTF
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200