LCAT Rabbit mAb, Clone: [ARC2383], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19228S
Article Name: LCAT Rabbit mAb, Clone: [ARC2383], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19228S
Supplier Catalog Number: CNA19228S
Alternative Catalog Number: MBL-CNA19228S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LCAT (P04180).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2383]
Molecular Weight: 50kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWI
Target: LCAT
Application Dilute: WB: WB,1:500 - 1:1000