Eph receptor B3 (EPHB3) Rabbit mAb, Clone: [ARC2384], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19229S
Article Name: Eph receptor B3 (EPHB3) Rabbit mAb, Clone: [ARC2384], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19229S
Supplier Catalog Number: CNA19229S
Alternative Catalog Number: MBL-CNA19229S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Eph receptor B3 (EPHB3) (EPHB3) (P54753).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2384]
Molecular Weight: 110kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: SELAWTSHPESGWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWM
Target: EPHB3
Application Dilute: WB: WB,1:500 - 1:1000