DCTN5 Rabbit mAb, Clone: [ARC2412], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19251S
Article Name: DCTN5 Rabbit mAb, Clone: [ARC2412], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19251S
Supplier Catalog Number: CNA19251S
Alternative Catalog Number: MBL-CNA19251S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human DCTN5 (Q9BTE1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2412]
Molecular Weight: 20kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
Target: DCTN5
Application Dilute: WB: WB,1:500 - 1:1000