PROK1 Rabbit mAb, Clone: [ARC2439], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19268S
Article Name: PROK1 Rabbit mAb, Clone: [ARC2439], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19268S
Supplier Catalog Number: CNA19268S
Alternative Catalog Number: MBL-CNA19268S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human PROK1 (P58294).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2439]
Molecular Weight: 12kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Target: PROK1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200