ATP1A2 Rabbit mAb, Clone: [ARC2458], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19278S
Article Name: ATP1A2 Rabbit mAb, Clone: [ARC2458], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19278S
Supplier Catalog Number: CNA19278S
Alternative Catalog Number: MBL-CNA19278S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP1A2 (P50993).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2458]
Molecular Weight: 112kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSI
Target: ATP1A2
Application Dilute: WB: WB,1:500 - 1:1000