TNNC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1927S
Article Name: TNNC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1927S
Supplier Catalog Number: CNA1927S
Alternative Catalog Number: MBL-CNA1927S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TNNC1 (NP_003271.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 18kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV
Target: TNNC1
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200