CTNNA3 Rabbit mAb, Clone: [ARC2463], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19282S
Article Name: CTNNA3 Rabbit mAb, Clone: [ARC2463], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19282S
Supplier Catalog Number: CNA19282S
Alternative Catalog Number: MBL-CNA19282S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-895 of human CTNNA3 (Q9UI47).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2463]
Molecular Weight: 100kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DIIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAGPRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY
Target: CTNNA3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200