ICAM-1/CD54 Rabbit mAb, Clone: [ARC0261], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19300S
Article Name: ICAM-1/CD54 Rabbit mAb, Clone: [ARC0261], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19300S
Supplier Catalog Number: CNA19300S
Alternative Catalog Number: MBL-CNA19300S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: FC, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ICAM-1/CD54 (P05362).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0261]
Molecular Weight: 58kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ
Target: ICAM1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|FC,1:50 - 1:200