Caspase-4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA19305S
Article Name: Caspase-4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA19305S
Supplier Catalog Number: CNA19305S
Alternative Catalog Number: MBL-CNA19305S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-4 (NP_001216.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 43kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
Target: CASP4
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200