GJA8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA19312T
Article Name: GJA8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA19312T
Supplier Catalog Number: CNA19312T
Alternative Catalog Number: MBL-CNA19312T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 234-433 of human GJA8 (NP_005258.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 48kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SALKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSKASSRARSDDLTV
Target: GJA8
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200