PI4KA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA19329T
Article Name: PI4KA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA19329T
Supplier Catalog Number: CNA19329T
Alternative Catalog Number: MBL-CNA19329T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1780-1860 of human PI4KA (P42356).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 237kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDML
Target: PI4KA
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200