GLO1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1932S
Article Name: GLO1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1932S
Supplier Catalog Number: CNA1932S
Alternative Catalog Number: MBL-CNA1932S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human GLO1 (NP_006699.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 21kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Target: GLO1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200