[KD Validated] RAB27A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1934S
Article Name: [KD Validated] RAB27A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1934S
Supplier Catalog Number: CNA1934S
Alternative Catalog Number: MBL-CNA1934S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human RAB27A (NP_899057.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 25kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Target: RAB27A
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200