Glypican 3 (GPC3) Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1946P
Article Name: |
Glypican 3 (GPC3) Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA1946P |
Supplier Catalog Number: |
CNA1946P |
Alternative Catalog Number: |
MBL-CNA1946P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
FC, WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 481-580 of human Glypican 3 (GPC3) (NP_004475.1). |
Conjugation: |
Unconjugated |
Clonality: |
Polyclonal |
Molecular Weight: |
66kDa |
Buffer: |
PBS with 0.05% proclin300,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,50% glycerol |
Sequence: |
GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH |
Target: |
GPC3 |
Application Dilute: |
WB: WB,1:500 - 1:1000|FC,1:50 - 1:200 |