Acetyl-Histone H4-K5 Rabbit mAb, Clone: [ARC0002], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19525S
Article Name: Acetyl-Histone H4-K5 Rabbit mAb, Clone: [ARC0002], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19525S
Supplier Catalog Number: CNA19525S
Alternative Catalog Number: MBL-CNA19525S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: DOT, ICC, IF, IHC-P, WB
Species Reactivity: All, Human, Mouse, Rat
Immunogen: A synthetic acetylated peptide around K5 of human Histone H4 (P62805).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0002]
Molecular Weight: 11kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Target: Histone H4
Application Dilute: WB: DB,1:500 - 1:1000|WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200