HIF1beta/ARNT Rabbit mAb, Clone: [ARC0010], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19532S
Article Name: HIF1beta/ARNT Rabbit mAb, Clone: [ARC0010], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19532S
Supplier Catalog Number: CNA19532S
Alternative Catalog Number: MBL-CNA19532S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 499-789 of human HIF-1 beta (P27540).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0010]
Molecular Weight: 87kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQ
Target: ARNT
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200