AIF Rabbit mAb, Clone: [ARC0015], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19536S
Article Name: AIF Rabbit mAb, Clone: [ARC0015], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19536S
Supplier Catalog Number: CNA19536S
Alternative Catalog Number: MBL-CNA19536S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human AIF (O95831).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0015]
Molecular Weight: 67kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAV
Target: AIFM1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200