C/EBPB Rabbit mAb, Clone: [ARC0017], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19538S
Article Name: C/EBPB Rabbit mAb, Clone: [ARC0017], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19538S
Supplier Catalog Number: CNA19538S
Alternative Catalog Number: MBL-CNA19538S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 246-345 of human C/EBPB (P17676).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0017]
Molecular Weight: 36kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: TACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
Target: CEBPB
Application Dilute: WB: WB,1:500 - 1:1000