RARalpha Rabbit mAb, Clone: [ARC0030], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19551S
Article Name: RARalpha Rabbit mAb, Clone: [ARC0030], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19551S
Supplier Catalog Number: CNA19551S
Alternative Catalog Number: MBL-CNA19551S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RARalpha (P10276).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0030]
Molecular Weight: 51kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHY
Target: RARA
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200