KAP1/TRIM28 Rabbit mAb, Clone: [ARC0047], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19568S
Article Name: KAP1/TRIM28 Rabbit mAb, Clone: [ARC0047], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19568S
Supplier Catalog Number: CNA19568S
Alternative Catalog Number: MBL-CNA19568S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human KAP1/TRIM28 (Q13263).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0047]
Molecular Weight: 89kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFAS
Target: TRIM28
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000