[KO Validated] SOD2 Rabbit mAb, Clone: [ARC0055], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19576S
Article Name: [KO Validated] SOD2 Rabbit mAb, Clone: [ARC0055], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19576S
Supplier Catalog Number: CNA19576S
Alternative Catalog Number: MBL-CNA19576S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOD2 (P04179).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0055]
Molecular Weight: 25kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSI
Target: SOD2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200