Fas Rabbit mAb, Clone: [ARC0061], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19582P
Article Name: Fas Rabbit mAb, Clone: [ARC0061], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19582P
Supplier Catalog Number: CNA19582P
Alternative Catalog Number: MBL-CNA19582P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Fas (NP_000034.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0061]
Molecular Weight: 38kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: EGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCE
Target: FAS
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200