[KD Validated] NQO1 Rabbit mAb, Clone: [ARC56753], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19586S
Article Name: [KD Validated] NQO1 Rabbit mAb, Clone: [ARC56753], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19586S
Supplier Catalog Number: CNA19586S
Alternative Catalog Number: MBL-CNA19586S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NQO1 (P15559).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC56753]
Molecular Weight: 31kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIF
Target: NQO1
Application Dilute: WB: WB,1:5000 - 1:20000|IF/ICC,1:100 - 1:500