SMC3 Rabbit mAb, Clone: [ARC2186], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19591S
Article Name: SMC3 Rabbit mAb, Clone: [ARC2186], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19591S
Supplier Catalog Number: CNA19591S
Alternative Catalog Number: MBL-CNA19591S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2186]
Molecular Weight: 142kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG
Target: SMC3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000