PARP1 Rabbit mAb, Clone: [ARC0075], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19596P
Article Name: PARP1 Rabbit mAb, Clone: [ARC0075], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19596P
Supplier Catalog Number: CNA19596P
Alternative Catalog Number: MBL-CNA19596P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PARP1 (P09874).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0075]
Molecular Weight: 113kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: KLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD
Target: PARP1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200