Cathepsin D Rabbit mAb, Clone: [ARC0160], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19680S
Article Name: Cathepsin D Rabbit mAb, Clone: [ARC0160], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19680S
Supplier Catalog Number: CNA19680S
Alternative Catalog Number: MBL-CNA19680S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 313-412 of human Cathepsin D (P07339).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0160]
Molecular Weight: 45kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Target: CTSD
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200