Bax Rabbit mAb, Clone: [ARC0164], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19684P
Article Name: Bax Rabbit mAb, Clone: [ARC0164], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19684P
Supplier Catalog Number: CNA19684P
Alternative Catalog Number: MBL-CNA19684P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (Q07812).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0164]
Molecular Weight: 21kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Target: BAX
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200