Bcl-2 Rabbit mAb, Clone: [ARC0173], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19693S
Article Name: Bcl-2 Rabbit mAb, Clone: [ARC0173], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19693S
Supplier Catalog Number: CNA19693S
Alternative Catalog Number: MBL-CNA19693S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-211 of human Bcl-2 (P10415).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0173]
Molecular Weight: 26kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Target: BCL2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:50 - 1:200