PIM1 Rabbit mAb, Clone: [ARC0175], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19695S
Article Name: PIM1 Rabbit mAb, Clone: [ARC0175], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19695S
Supplier Catalog Number: CNA19695S
Alternative Catalog Number: MBL-CNA19695S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIM1 (P11309).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0175]
Molecular Weight: 36kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGF
Target: PIM1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200