Progesterone Receptor Rabbit mAb, Clone: [ARC51400], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19697P
Article Name: Progesterone Receptor Rabbit mAb, Clone: [ARC51400], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19697P
Supplier Catalog Number: CNA19697P
Alternative Catalog Number: MBL-CNA19697P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51400]
Molecular Weight: 99kd(CST:90,118KD)
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: AAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYD
Target: PGR
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200