SQSTM1/p62 Rabbit mAb, Clone: [ARC0180], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19700S
Article Name: SQSTM1/p62 Rabbit mAb, Clone: [ARC0180], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19700S
Supplier Catalog Number: CNA19700S
Alternative Catalog Number: MBL-CNA19700S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 341-440 of human SQSTM1/p62 (Q13501).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0180]
Molecular Weight: 48kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Target: SQSTM1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000