HSPA4 Rabbit mAb, Clone: [ARC2237], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19705S
Article Name: HSPA4 Rabbit mAb, Clone: [ARC2237], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19705S
Supplier Catalog Number: CNA19705S
Alternative Catalog Number: MBL-CNA19705S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human HSPA4 (P34932).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2237]
Molecular Weight: 94kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNA
Target: HSPA4
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200