5HT7 Receptor Rabbit mAb, Clone: [ARC2238], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19706S
Article Name: 5HT7 Receptor Rabbit mAb, Clone: [ARC2238], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19706S
Supplier Catalog Number: CNA19706S
Alternative Catalog Number: MBL-CNA19706S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 5HT7 Receptor (P34969).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2238]
Molecular Weight: 54kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNC
Target: HTR7
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200