IGHD Rabbit mAb, Clone: [ARC2240], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19708S
Article Name: IGHD Rabbit mAb, Clone: [ARC2240], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19708S
Supplier Catalog Number: CNA19708S
Alternative Catalog Number: MBL-CNA19708S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IGHD (P01880).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2240]
Molecular Weight: 42kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQPQRTFPEIQRRDSYYMTSSQLSTPLQQWRQGEYKCVVQHTASKSKKEIFRW
Target: IGHD
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200