Human IgM Rabbit mAb, Clone: [ARC2245], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19719S
Article Name: Human IgM Rabbit mAb, Clone: [ARC2245], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19719S
Supplier Catalog Number: CNA19719S
Alternative Catalog Number: MBL-CNA19719S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-453 of human IgM (P01871).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2245]
Molecular Weight: 49kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDS
Target: IGHM
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200